Sermorelin
Sermorelin is the synthetic 29-residue N-terminal fragment of human growth hormone-releasing hormone (GHRH 1-29 amide), which retains activity at the GHRH receptor.
- TypePeptide
- FormulaC149H246N44O42S
- Average mass3357.88 g/mol
- CAS86168-78-7
- Vesta listings3
Reference page for laboratory use · updated 2026-10-30
Overview
Sermorelin at a glance
Native GHRH has 44 residues. Experiments in the 1980s showed that the first 29 residues are enough to stimulate growth hormone release, and sermorelin is therefore described as GRF(1-29)-NH2 in the older literature.
In research it is used as a reference GHRH-receptor agonist and as an analytical reference when developing detection methods for GHRH analogues.
Structure
The sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSR with a C-terminal amide. It contains a single methionine at position 27 and an asparagine at position 8.
Identity
Identity data
| Name | Sermorelin |
|---|---|
| Also written as | GRF(1-29), GHRH(1-29)NH2 |
| Type | Peptide |
| Research area | Growth hormone axis peptides |
| Molecular formula | C149H246N44O42S |
| Monoisotopic mass | 3355.8187 Da |
| Average molecular weight | 3357.88 g/mol |
| CAS number | 86168-78-7 |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 |
| PubChem record | CID 16132413 |
The formula was calculated independently from the written sequence and matches the PubChem record exactly. Reference data retrieved on 2026-10-30. Compare these values with the batch certificate of analysis, using the compound identity file template.
Expected values
Mass spectrometry reference
Ions calculated from the monoisotopic mass 3355.8187 Da. Use them to check an LC-MS result; for larger peptides the instrument usually reports a deconvoluted mass close to 3357.9 Da instead.
| Ion | m/z |
|---|---|
| [M+3H]3+ | 1119.6135 |
| [M+4H]4+ | 839.9620 |
| [M+5H]5+ | 672.1710 |
| [M+6H]6+ | 560.3104 |
For molecules of this size the tallest isotope peak is one to two mass units above the monoisotopic peak. Read the guide to average and monoisotopic mass for how these values are calculated.
Quality
Analytical notes for batch documents
- Methionine oxidation (+15.995 Da) and asparagine deamidation (+0.984 Da) are the typical modifications to look for in a GHRH-type peptide.
- The calculated formula from the sequence matches the PubChem record, so the masses in the table can be used as the expected values.
- Mass shifts to look for in this sequence: methionine oxidation (+15.995 Da); deamidation of Asn or Gln (+0.984 Da).
- The molecular weight of a vial of powder includes counter-ions and water; the share of the powder that is peptide is the net peptide content.
Terms used on this page: Methionine oxidation, Deamidation, Peptide.
Vesta listings
Sermorelin formats and prices
| Product | Per vial | SKU | Price per kit | Price per vial |
|---|---|---|---|---|
| Sermorelin | 5 mg | SM05 | $98.88 | $9.89 |
| Sermorelin | 10 mg | SM010 | $160.45 | $16.04 |
| Sermorelin | 20 mg | SM020 | $289.18 | $28.92 |
Prices are per kit of 10 vials in US dollars. Shipping is paid by the customer and is shown in the cart. Volume savings of 5 %, 8 % and 10 % apply from $350.00, $600.00 and $1,000.00. See the full price list.
Published literature
Selected scientific literature
Bibliographic details were read from PubMed on 2026-10-30. The papers are listed for scientific reference; Vesta makes no claim about the use of its research materials in people or animals.
- Advances in the detection of growth hormone releasing hormone synthetic analogsMemdouh S, Gavrilović I, Ng K et al. · Drug Test Anal · 2021 · PMID 34665524
- A comparison of the biological activities of authentic rat GRF(1-43)OH with the analogue rat GRF(1-29)NH2Kraicer J, French MB, Lussier BT et al. · Can J Physiol Pharmacol · 1991 · PMID 1829020
Questions
Frequently asked questions
What is Sermorelin?
Sermorelin is the synthetic 29-residue N-terminal fragment of human growth hormone-releasing hormone (GHRH 1-29 amide), which retains activity at the GHRH receptor.
What is the molecular weight of Sermorelin?
Sermorelin has the formula C149H246N44O42S, an average molecular weight of 3357.88 g/mol and a monoisotopic mass of 3355.8187 Da. A salt form, a different counter-ion or a metal complex changes the molecular weight printed on a certificate of analysis, so compare like with like.
How can I check the identity of a batch of Sermorelin?
Compare the intact mass measured by LC-MS with the expected values on this page, for example [M+4H]4+ at m/z 839.9620. Confirm that one main HPLC peak carries that mass and that the batch code on the report matches the vial. The guides on mass spectrometry and on certificates of analysis explain each step.
Which Sermorelin products does Vesta list?
Vesta lists 3 products for Sermorelin: 5 mg, 10 mg, 20 mg per vial in kits of 10 vials. Prices are shown per kit in US dollars, and shipping is paid by the customer.