CJC-1295
CJC-1295 is a synthetic analogue of GHRH(1-29) with four amino acid substitutions; the version with a drug affinity complex (DAC) carries a reactive group that allows covalent binding to serum albumin.
- TypePeptide
- FormulaC165H269N47O46
- Average mass3647.19 g/mol
- CAS446262-90-4
- Vesta listings6
Reference page for laboratory use · updated 2026-10-30
Overview
CJC-1295 at a glance
The name is used for two different molecules. CJC-1295 without DAC is the tetrasubstituted GRF(1-29) peptide, often written Modified GRF(1-29). CJC-1295 with DAC is the same peptide with a lysine-linked maleimidopropionamide group added.
Published work includes the original characterisation of the DAC version and analytical papers on its identification in unknown preparations and in biological samples.
Structure
The peptide part is YADAIFTQSYRKVLAQLSARKLLQDILSR-NH2 with D-alanine at position 2 and substitutions at positions 8, 15 and 27. The DAC version adds a lysine-based linker with a reactive maleimide group.
Identity
Identity data
| Name | CJC-1295 |
|---|---|
| Also written as | Modified GRF(1-29), CJC-1295 DAC, DAC:GRF |
| Type | Peptide |
| Research area | Growth hormone axis peptides |
| Molecular formula | C165H269N47O46 |
| Monoisotopic mass | 3645.0155 Da |
| Average molecular weight | 3647.19 g/mol |
| CAS number | 446262-90-4 |
| PubChem record | CID 91971820 |
| CJC-1295 without DAC (modified GRF 1-29) | C152H252N44O42 · average 3367.90 g/mol · monoisotopic 3365.8936 Da |
The formula comes from the PubChem record; monoisotopic mass is calculated from the formula and the average mass uses standard atomic weights. Reference data retrieved on 2026-10-30. Compare these values with the batch certificate of analysis, using the compound identity file template.
Expected values
Mass spectrometry reference
Ions calculated from the monoisotopic mass 3645.0155 Da. Use them to check an LC-MS result; for larger peptides the instrument usually reports a deconvoluted mass close to 3647.2 Da instead.
| Ion | m/z |
|---|---|
| [M+3H]3+ | 1216.0124 |
| [M+4H]4+ | 912.2612 |
| [M+5H]5+ | 730.0104 |
| [M+6H]6+ | 608.5099 |
For molecules of this size the tallest isotope peak is one to two mass units above the monoisotopic peak. Read the guide to average and monoisotopic mass for how these values are calculated.
Quality
Analytical notes for batch documents
- Check that the COA states which form was tested: the masses differ by about 280 Da, so identity is easy to confirm from the intact mass.
- The mass for the DAC form in the table is the PubChem value; the mass for the form without DAC is calculated from the sequence and is shown separately.
- The molecular weight of a vial of powder includes counter-ions and water; the share of the powder that is peptide is the net peptide content.
Terms used on this page: Peptide.
Vesta listings
CJC-1295 formats and prices
| Product | Per vial | SKU | Price per kit | Price per vial |
|---|---|---|---|---|
| CJC1295 with DAC | 5 mg | CD5 | $216.42 | $21.64 |
| CJC1295 no DAC | 5 mg | CND5 | $98.88 | $9.89 |
| CJC1295 with DAC | 10 mg | CD10 | $391.79 | $39.18 |
| CJC1295 no DAC | 10 mg | CND10 | $167.91 | $16.79 |
Research blends that contain CJC-1295
| Product | Per vial | SKU | Price per kit | Price per vial |
|---|---|---|---|---|
| CJC1295+Ipamorelin | 10 mg | CP10 | $141.79 | $14.18 |
| CJC1295+Ipamorelin | 20 mg | CP20 | $263.06 | $26.31 |
Prices are per kit of 10 vials in US dollars. Shipping is paid by the customer and is shown in the cart. Volume savings of 5 %, 8 % and 10 % apply from $350.00, $600.00 and $1,000.00. See the full price list.
Published literature
Selected scientific literature
Bibliographic details were read from PubMed on 2026-10-30. The papers are listed for scientific reference; Vesta makes no claim about the use of its research materials in people or animals.
- Identification of CJC-1295, a growth-hormone-releasing peptide, in an unknown pharmaceutical preparationHenninge J, Pepaj M, Hullstein I et al. · Drug Test Anal · 2010 · PMID 21204297
- Activation of the GH/IGF-1 axis by CJC-1295, a long-acting GHRH analog, results in serum protein profile changes in normal adult subjectsSackmann-Sala L, Ding J, Frohman LA et al. · Growth Horm IGF Res · 2009 · PMID 19386527
- Prolonged stimulation of growth hormone (GH) and insulin-like growth factor I secretion by CJC-1295, a long-acting analog of GH-releasing hormone, in healthy adultsTeichman SL, Neale A, Lawrence B et al. · J Clin Endocrinol Metab · 2006 · PMID 16352683
Questions
Frequently asked questions
What is CJC-1295?
CJC-1295 is a synthetic analogue of GHRH(1-29) with four amino acid substitutions; the version with a drug affinity complex (DAC) carries a reactive group that allows covalent binding to serum albumin.
What is the molecular weight of CJC-1295?
CJC-1295 has the formula C165H269N47O46, an average molecular weight of 3647.19 g/mol and a monoisotopic mass of 3645.0155 Da. A salt form, a different counter-ion or a metal complex changes the molecular weight printed on a certificate of analysis, so compare like with like.
How can I check the identity of a batch of CJC-1295?
Compare the intact mass measured by LC-MS with the expected values on this page, for example [M+4H]4+ at m/z 912.2612. Confirm that one main HPLC peak carries that mass and that the batch code on the report matches the vial. The guides on mass spectrometry and on certificates of analysis explain each step.
Which CJC-1295 products does Vesta list?
Vesta lists 6 products for CJC-1295: 5 mg, 10 mg per vial in kits of 10 vials, plus 2 research blends that contain it. Prices are shown per kit in US dollars, and shipping is paid by the customer.
What is the difference between CJC-1295 with DAC and without DAC?
They are two different molecules. The version without DAC is the modified GRF(1-29) peptide. The version with DAC adds a lysine-linked reactive group so that the peptide can bind serum albumin covalently. Their molecular weights differ, so the intact mass on a COA shows which one was supplied.